Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0294000_circ_g.10 |
| ID in PlantcircBase | osa_circ_038761 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 7006863-7008377 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0294000 |
| Parent gene annotation |
Similar to Bifunctional aspartokinase/homoserine dehydrogenase 2 , chloroplast precursor (AK-HD 2) (AK-HSDH 2) [Includes: Asparto kinase (EC 2.7.2.4); Homoserine dehydrogenase (EC 1.1.1.3)]. (Os 09t0294000-01);Similar to Aspartate kinase-homoserine dehydrogen ase. (Os09t0294000-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0294000_circ_g.11 Os09g0294000_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0294000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149850545 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7007189-7008372(-) |
| Potential amino acid sequence |
MWSVHKFGGTCMGTPQRIQNVADIVLGDSSERKLIIVSAMSKVTDMMFNLVHKAQSRDNSYVTA LDEVFNKHMAAAKELLDGEDLARFLAQLHSDISNLRAMLRAIFIGK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |