Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0715400_circ_g.1 |
| ID in PlantcircBase | osa_circ_003637 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 29762631-29763217 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0715400 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0715400-01);Conserved hypothe tical protein. (Os01t0715400-02);Glycoside hydrolase, subgroup, catalytic domain domain containing protein. (Os01t0715400-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0715400-03:2 Os01t0715400-01:2 Os01t0715400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25126289 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29763207-29762641(+) 29762651-29763140(-) |
| Potential amino acid sequence |
MSGQDYAIETSLDTPHNSEGKTIHEVQIKIDKGTSIAAINFVLKEEETGAWFQHKGQDFRIPLS GSFGGDLLGTEQDIDVRPGLCN*(+) MFQLHSPGLTSISCSVPSRSPPKDPLKGILKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |