Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0781850_circ_g.1 |
| ID in PlantcircBase | osa_circ_016804 |
| Alias | Os02circ28194/Os_ciR8145 |
| Organism | Oryza sativa |
| Position | chr2: 33130109-33130388 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os02g0781850 |
| Parent gene annotation |
Hypothetical protein. (Os02t0781850-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2/5/6 |
| Tissues | panicle/root/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0781800-02:1 Os02t0781800-01:1 Os02t0781800-02:1 Os02t0781800-01:1 Os02t0781850-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004342* osi_circ_012370 |
| PMCS | 0.428396042 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33130328-33130145(+) 33130348-33130386(-) |
| Potential amino acid sequence |
MNAEGVMNSVLLTSIKLEFLTYALAAATISDLL*(+) MTPSAFIFLYENNLFLTFCNRTVAAWNFRGELVTSFDDHELWHSNCNTNNIYITADQDLIISYC KASKEVRDSGGCEGIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |