Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0781850_circ_g.1 |
ID in PlantcircBase | osa_circ_016804 |
Alias | Os02circ28194/Os_ciR8145 |
Organism | Oryza sativa |
Position | chr2: 33130109-33130388 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os02g0781850 |
Parent gene annotation |
Hypothetical protein. (Os02t0781850-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/2/5/6 |
Tissues | panicle/root/root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0781800-02:1 Os02t0781800-01:1 Os02t0781800-02:1 Os02t0781800-01:1 Os02t0781850-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004342* osi_circ_012370 |
PMCS | 0.428396042 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33130328-33130145(+) 33130348-33130386(-) |
Potential amino acid sequence |
MNAEGVMNSVLLTSIKLEFLTYALAAATISDLL*(+) MTPSAFIFLYENNLFLTFCNRTVAAWNFRGELVTSFDDHELWHSNCNTNNIYITADQDLIISYC KASKEVRDSGGCEGIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |