Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0367000_circ_g.1 |
ID in PlantcircBase | osa_circ_019960 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 14359843-14359927 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os03g0367000 |
Parent gene annotation |
Similar to Pasticcino 1-A. (Os03t0367000-01);Hypothetical conser ved gene. (Os03t0367000-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0367000-02:1 Os03t0367000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14359872-14359899(+) |
Potential amino acid sequence |
MKGLIRSGGGDATPAEGDQEEEAYSGELDEGAYSVWWG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |