Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0469400_circ_g.2 |
| ID in PlantcircBase | osa_circ_039521 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 17858822-17859290 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os09g0469400 |
| Parent gene annotation |
Similar to isoamylase-type starch debranching enzyme ISO3. (Os09 t0469400-01);Similar to isoamylase-type starch debranching enzym e ISO3. (Os09t0469400-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0469400_circ_g.1 Os09g0469400_circ_g.3 |
| Support reads | 2 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0469400-01:3 Os09t0469400-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257400835 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17859248-17859275(-) |
| Potential amino acid sequence |
MKNFHVALMISQGTPMMLMGDEYGHTRYGNNNSYGHDTCINNFQWEQLEQRRDGHFRFFSEMIK FRHSNPILRRDRFLNKEKQMI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |