Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0524100_circ_g.1 |
| ID in PlantcircBase | osa_circ_037749 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 26066715-26066868 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0524100 |
| Parent gene annotation |
Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein). (Os08t0524 100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0524100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.392305087 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26066858-26066734(+) |
| Potential amino acid sequence |
MDLQGGVGLRIRVYDRRICFVNNHFAAHLENVSRRNADFDHIYRTMTFNKPHGSAGWCRVKN*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |