Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0691800_circ_g.2 |
| ID in PlantcircBase | osa_circ_021067 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 27672629-27672870 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0691800 |
| Parent gene annotation |
Similar to HIPL1 protein precursor. (Os03t0691800-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0691800_circ_g.3 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0691800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230367493 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27672771-27672644(+) 27672754-27672636(+) 27672739-27672862(-) |
| Potential amino acid sequence |
MGYSHSAINKNTGSASITGGFVYRGSSDPCLYGRIYMKR*(+) MPSSLLWATAILLSTRTLGLHQLQVDLFIEGLLIPAYMEGFI*(+) MYSLQESILDDKCMGPHMHAIHSFHPSRSNLPLHINPSI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |