Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0355500_circ_g.3 |
| ID in PlantcircBase | osa_circ_001676 |
| Alias | Os_ciR5737 |
| Organism | Oryza sativa |
| Position | chr1: 14298235-14298858 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0355500 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0355500-01);Heat shock protei n DnaJ, N-terminal domain containing protein. (Os01t0355500-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0355500_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0355500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138827043 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14298794-14298246(+) 14298238-14298296(-) |
| Potential amino acid sequence |
MSLFLLPLNLQITLIFLSKSFCILQR*(+) MQKLLLRKMSVICKFSGSRKRDIELVKHLILR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |