Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0728700_circ_g.4 |
ID in PlantcircBase | osa_circ_032493 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 31027727-31028112 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0728700 |
Parent gene annotation |
Homeodomain-like containing protein. (Os06t0728700-01) |
Parent gene strand | - |
Alternative splicing | Os06g0728700_circ_g.2 Os06g0728700_circ_g.3 Os06g0728700_circ_g.5 |
Support reads | 4 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0728700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016673 |
PMCS | 0.385731047 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31028048-31028038(-) 31027755-31028038(-) |
Potential amino acid sequence |
MMNDASATVTAMQPNEGMEEFPVKVRKPYTITKQREKWTEEEHDKFLEALKLYGRSWRQIQGKG FIRFGNQQRPVAGSCQISLDDE*(-) MVALGVRYKEKDSSDLAINKGPSLDLVKSPLMMNDASATVTAMQPNEGMEEFPVKVRKPYTITK QREKWTEEEHDKFLEALKLYGRSWRQIQGKGFIRFGNQQRPVAGSCQISLDDE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |