Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G52140_circ_g.24 |
| ID in PlantcircBase | ath_circ_027113 |
| Alias | Ath_circ_FC2345 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 19339077-19339407 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G52140 |
| Parent gene annotation |
Clustered mitochondria protein homolog |
| Parent gene strand | + |
| Alternative splicing | AT3G52140_circ_g.7 AT3G52140_circ_g.8 AT3G52140_circ_g.9 AT3G52140_circ_g.10 AT3G52140_circ_g.11 AT3G52140_circ_g.12 AT3G52140_circ_g.13 AT3G52140_circ_g.14 AT3G52140_circ_g.15 AT3G52140_circ_g.16 AT3G52140_circ_g.17 AT3G52140_circ_g.18 AT3G52140_circ_g.19 AT3G52140_circ_g.20 AT3G52140_circ_g.21 AT3G52140_circ_g.22 AT3G52140_circ_g.23 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G52140.2:2 AT3G52140.3:1 AT3G52140.1:2 AT3G52140.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.163482276 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19339384-19339404(+) |
| Potential amino acid sequence |
MGKVQLAEFELPELSRTTAKKVSVLRNLCQKVGVSIAARKYDFSANTPFETSDILDLRPVIKHS VPVCSEAKDLVEMGKVQLAEFELPELSRTTAKKVSVLRNLCQKVGVSIAARKYDFSANTPFETS DILDLRPVIKHSVPVCSEAKDLVEMGKVQLAEFELPELSRTTAKKVSVLRNLCQKVGVSIAARK YDFSANTPFETSDILDLRPVIKHSVPVCSEAKDLVEMGKVQLAE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |