Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d031259_circ_g.2 |
ID in PlantcircBase | zma_circ_006697 |
Alias | zma_circ_0000328 |
Organism | Zea mays |
Position | chr1: 184114658-184114851 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d031259 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Zm00001d031259_circ_g.3 Zm00001d031259_circ_g.4 Zm00001d031259_circ_g.5 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d031259_T003:1 Zm00001d031259_T004:1 Zm00001d031259_T002:1 Zm00001d031259_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.13681876 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
184114806-184114665(+) 184114711-184114665(+) 184114697-184114799(-) |
Potential amino acid sequence |
MLHNLHSILHESHRLVFSVTASTFSASSSTTSAMCSTSSTAFCRDPSSGSCLATFAASFSVTSA KCSTTSTAFSTNPTVSSFQ*(+) MCSTSSTAFCRDPSSGSCLATFAASFSVTSAKCSTTSTAFSTNPTVSSFQ*(+) MMMRRRLKQSLKRRDGGIRGECCGGCGAFS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |