Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G30690_circ_g.5 |
| ID in PlantcircBase | ath_circ_033700 |
| Alias | AT4G30690_C1, AT4G30690_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 14961224-14961558 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G30690 |
| Parent gene annotation |
Translation initiation factor IF3-4, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT4G30690_circ_g.1 AT4G30690_circ_g.2 AT4G30690_circ_g.3 AT4G30690_circ_g.4 AT4G30690_circ_g.6 AT4G30690_circ_g.7 AT4G30690_circ_g.8 AT4G30690_circ_g.9 AT4G30690_circ_g.10 AT4G30690_circ_g.11 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G30690.1:3 AT4G30690.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186861344 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14961401-14961261(+) 14961521-14961261(+) |
| Potential amino acid sequence |
MMDYSKYRYEQQKRKKEQQKKNWFSFQRRSCSKS* MSSKRGKRNSRRKIGLVSKEEAVRRAEDAELDLVILSPDADPPVVRMMDYSKYRYEQQKRKKEQ QKKNWFSFQRRSCSKS* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |