Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_18G275500_circ_g.2 |
| ID in PlantcircBase | gma_circ_004823 |
| Alias | Gm18circRNA2487 |
| Organism | Glycine max |
| Position | chr18: 55772813-55773937 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_18G275500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_18G275500_circ_g.1 GLYMA_18G275500_circ_g.3 |
| Support reads | NA |
| Tissues | stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | KRH01417:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.050655096 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
55773891-55773894(-) 55772869-55773932(-) |
| Potential amino acid sequence |
MPEIQSTTSSKGISSQFKSFAYLYNEEQFVLSLAKDVTVVRTLPKDLKGARRKKEIPVFKVPYS ASPFYYFHHVLPVLKKHSVVELVVSEGGCLKATLPPNFEEYQRLRCRVSFHALQFRQEVQELSA KILQRYVMLLWLLDFSMLH*(-) MLFSFDRKSRNFLLRFCRDM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |