Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d017298_circ_g.1 |
ID in PlantcircBase | zma_circ_008760 |
Alias | zma_circ_0001960 |
Organism | Zea mays |
Position | chr5: 192057631-192062241 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d017298 |
Parent gene annotation |
DUF3755 family protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d017298_T006:4 Zm00001d017298_T011:7 Zm00001d017298_T002:7 Zm00001d017298_T009:5 Zm00001d017298_T010:7 Zm00001d017298_T003:7 Zm00001d017298_T004:7 Zm00001d017298_T005:3 Zm00001d017298_T008:7 Zm00001d017298_T013:5 Zm00001d017298_T007:7 Zm00001d017298_T001:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.062649452 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
192061952-192062235(-) |
Potential amino acid sequence |
MQMSTGSNHYGVFPHPFCNQHVVSFQTSSITSGSGAIPVCLDTSSGMNGDMAMLNTTSSTIVST GSPNMVADSSCQNLKYSAPLAVEWSYPELQLLNDGLNKYANEPGIMKYIKIAATLPDKTVRDVA MRCQWMAARKEATRRRKPEERYLGKKIKDRKDKMAQPSSWGTNPPVQAEMRSSSFMPRNAKHNG FLSGDSQIDHEMLNILEENARLLNQIEVNILTSQAHNNINLFHHIRRNINGLLQSMCQIPGIMS KMPPLPVSVDERLASYILPRAHTEV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |