Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0764250_circ_g.5 |
| ID in PlantcircBase | osa_circ_022009 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 31617217-31617867 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0764250 |
| Parent gene annotation |
Hypothetical gene. (Os03t0764250-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0764250_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0764300-01:1 Os03t0764300-02:1 Os03t0764250-01:1 Os03t0764300-01:1 Os03t0764300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.271986201 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31617716-31617279(+) 31617832-31617290(+) 31617303-31617865(-) |
| Potential amino acid sequence |
MFNLNVNVSAELLSCNFSLNAFLRCPQLIPFVPFDRKSPCSGFFCTVLAITLLAASYTHPNVPL PMSFPFCH*(+) MLRVFLHRFSHHSIGGLIYTSKCSTANELSFLPLTSH*(+) MHPQWLVSGKKESSLAVEHLDVYMRPPIE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |