Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0493800_circ_g.1 |
| ID in PlantcircBase | osa_circ_039685 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 19126478-19126624 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0493800 |
| Parent gene annotation |
Similar to Chaperone protein dnaJ 10 (AtJ10) (AtDjC10). (Os09t04 93800-01);Similar to Chaperone protein dnaJ 10 (AtJ10) (AtDjC10) . (Os09t0493800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0493800-02:1 Os09t0493800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.362290816 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19126527-19126480(-) 19126562-19126572(-) |
| Potential amino acid sequence |
MSPREHPYDPNPPYYQRVKLGSSEGEVTTINNTINNSDDNDGSSPDSSPMSPREHPYDPNPPYY QRVKLGSSEGEVTTINNTINNSDDNDGSSPDSSPMSPREHPYDPNPPYYQRVKLGSSEGEVTTI NNTINNSDDNDGSSPDSSPMSPREHPYDPNPPYYQ(-) MTMMVVLLIHHQCPQGSIHMIQTHRITSVLSLVLVRGRSQQSTIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |