Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G26180_circ_g.2 |
ID in PlantcircBase | ath_circ_004385 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 9055578-9055960 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G26180 |
Parent gene annotation |
Membrane protein |
Parent gene strand | + |
Alternative splicing | AT1G26180_circ_g.1 |
Support reads | 2 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G26180.1:3 AT1G26180.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.139686771 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9055590-9055957(+) |
Potential amino acid sequence |
MLLFILSGPVKALTYFLTHGLVGLALGSLWSMGASWRLSIFLCTMVATVMLLFILSGPVKALTY FLTHGLVGLALGSLWSMGASWRLSIFLCTMVATVMLLFILSGPVKALTYFLTHGLVGLALGSLW SMGASWRLSIFLCTMVATVMLLFILSGPVKALTYFLTHGLVGLALGSLWSMGASWRLSIFLCTM (+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |