Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0521000_circ_g.2 |
| ID in PlantcircBase | osa_circ_007711 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 20156714-20157460 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0521000 |
| Parent gene annotation |
Similar to TRE1 protein (Fragment). (Os10t0521000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0521000-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171281191 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20157420-20157039(+) 20157440-20157409(-) |
| Potential amino acid sequence |
MYMSKTMELKSGGWLQYECVQVHRYYARCCQSCHVSRIPHPSRAKIPSCFSCRSNLVVEFFFSS RRKF*(+) MVLDIYMATGDMAFVRRVFPSLLKEHSFWMSEVHNVAVMDNHGRVHNLSRYQAMWNKPRPESAT IDEEFASKLSTAAKEKFYHQVASTAETGWDFSSRWMRDSTDMTTLTTSCIIPVDLNTFILKPAT TFKLHGFRHIHGNW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |