Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0625900_circ_g.4 |
| ID in PlantcircBase | osa_circ_025405 |
| Alias | Os_ciR3035 |
| Organism | Oryza sativa |
| Position | chr4: 31827292-31828185 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0625900 |
| Parent gene annotation |
Similar to OSIGBa0148A10.9 protein. (Os04t0625900-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0625900_circ_g.1 Os04g0625900_circ_g.2 Os04g0625900_circ_g.3 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0625900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151372017 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31827296-31827302(+) 31828108-31828167(-) |
| Potential amino acid sequence |
MGHNVSRLDPARIGTPYHPMQVGPAYISPSPQPVTGGKFNHVVYVHPFSQDVMHGAPVMPQGWS LPAPLNSHQASLQKFQDHGA*(+) MHYILRKWVYINNMIKFPTSNRLRTRANVSRSNLHGMIRCANSSRIQPAHIMPHGLGTSGG*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |