Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Bra010712_circ_g.1 |
| ID in PlantcircBase | bra_circ_000397 |
| Alias | A08:15294652|15295238 |
| Organism | Brassica rapa |
| Position | chrA08: 15294652-15295238 JBrowse» |
| Reference genome | Brassica rapa v2 |
| Type | ie-circRNA |
| Identification method | Find_circ |
| Parent gene | Bra010712 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Bra0A10A712:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.802512583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15294993-15295225(-) |
| Potential amino acid sequence |
MLSLDVTKKCLVAEGWSPVFASKEIQEALERAAVDSNSQVGSIFQILRTKELPPTYFRTNKFTS AIQEIVDAYGFQVD* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2019 |