Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0500100_circ_g.1 |
| ID in PlantcircBase | osa_circ_037508 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 24687579-24689814 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0500100 |
| Parent gene annotation |
Similar to Peroxisomal targeting signal 1 receptor short form. ( Os08t0500100-01);Similar to Peroxisomal targeting sequence 1 rec eptor (Fragment). (Os08t0500100-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0500100_circ_g.2 Os08g0500100_circ_g.3 Os08g0500100_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0500100-02:4 Os08t0500100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117550492 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24689751-24687681(+) 24687723-24687620(+) 24687649-24689724(-) |
| Potential amino acid sequence |
MNFKPSTMLMQTLGRISLFMKRSTTKGLIWCPTFFPSKWSSWCAISTCSSTSAWFV*(+) MARHILADQPEEYIQAQVNTLLHSLDIDSNYRMKGPMHGPYPEMEEYWNQSQSAMRSGPMHNAA DKWITEFGKQNNNPEEWAHSFEQQYGSNGWASEFEQHQSQMAMTGGMNMANLAAMEQSRMLAQT LASNNDPKFQNSKFFQFVSKMSRGELIIEDNQVKQGSASQSSGWADEFQTQYNANANSWADQFV HEEVHHKGSYLVSYVLS*(+) MAHQLDHLLGKNVGHQIRPFVVDLFMNKLIRPRVCISIVLGLKFISPATGLGC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |