Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0485300_circ_g.2 |
| ID in PlantcircBase | osa_circ_028272 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 23867860-23868164 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0485300 |
| Parent gene annotation |
TRAM, LAG1 and CLN8 homology domain containing protein. (Os05t04 85300-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0485300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.121857923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23867979-23867922(+) 23868164-23867922(+) |
| Potential amino acid sequence |
MSDAMFGVSLGYFLTDLLMILWHFPSLGGKEYGILYLPRISCCCSLFLSAGDI*(+) MGFSTFHALVAAVVSFYLLVISDLFSKDVHGAIIIDRKSWMSDAMFGVSLGYFLTDLLMILWHF PSLGGKEYGILYLPRISCCCSLFLSAGDI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |