Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042114_circ_g.1 |
| ID in PlantcircBase | zma_circ_000200 |
| Alias | NA |
| Organism | Zea mays |
| Position | chr3: 151475154-151475256 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Zm00001d042114 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d042114_T001:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202767548 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
151475255-151475253(+) |
| Potential amino acid sequence |
MATRRQARSSREAAAGSRDAGGRRPRAGRRASSKDGYPTAGAEQQGGSGRKQGRRGKTTSRGEK GFIEGWLPDGRRGAAGRQRQEAGTPGEDDLARGEGLHRRM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |