Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G47890_circ_g.1 |
ID in PlantcircBase | ath_circ_018940 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 19608794-19608955 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G47890 |
Parent gene annotation |
Zinc finger protein CONSTANS-LIKE 13 |
Parent gene strand | + |
Alternative splicing | AT2G47890_circ_g.2 AT2G47890_circ_g.3 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G47890.3:1 AT2G47890.2:1 AT2G47890.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.160821175 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19608830-19608952(+) |
Potential amino acid sequence |
MIRQLRGLSRSEPGCLKFETPDAEIDAGFQFLAPDLFSTCELNRHATCGKYKDEMIRQLRGLSR SEPGCLKFETPDAEIDAGFQFLAPDLFSTCELNRHATCGKYKDEMIRQLRGLSRSEPGCLKFET PDAEIDAGFQFLAPDLFSTCELNRHATCGKYKDEMIRQLRGLSRSEPGCLKFETPDAEIDAGFQ FLAPDLFSTCEL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |