Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0128400_circ_g.9 |
| ID in PlantcircBase | osa_circ_000210 |
| Alias | Os_ciR2713 |
| Organism | Oryza sativa |
| Position | chr1: 1575576-1575713 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0128400 |
| Parent gene annotation |
Protein of unknown function DUF2359, TMEM214 domain containing p rotein. (Os01t0128400-01);Similar to predicted protein. (Os01t01 28400-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0128400_circ_g.1 Os01g0128400_circ_g.2 Os01g0128400_circ_g.3 Os01g0128400_circ_g.4 Os01g0128400_circ_g.5 Os01g0128400_circ_g.6 Os01g0128400_circ_g.7 Os01g0128400_circ_g.8 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0128400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374153261 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1575682-1575578(-) 1575579-1575640(-) |
| Potential amino acid sequence |
MRFADYFGRSFASVSAAQFPWAKMFKESLVSKMVDESYENQQDIQLMRFADYFGRSFASVSAAQ FPWAKMFKESLVSKMVDESYENQQDIQLMRFADYFGRSFASVSAAQFPWAKMFKESLVSKMVDE SYENQQDIQLMRFADYFGRSFASVSAAQFPWAKMFKESLVSKMVD(-) MNLTRTSRIFSSCGSPTTLAGHLQA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |