Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0417900_circ_g.3 |
ID in PlantcircBase | osa_circ_020318 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 17377744-17378817 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0417900 |
Parent gene annotation |
Similar to ARE1-like protein. (Os03t0417900-01) |
Parent gene strand | - |
Alternative splicing | Os03g0417900_circ_g.4 Os03g0417900_circ_g.5 Os03g0417900_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0417900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.24931603 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17378721-17377783(+) 17378751-17378775(-) |
Potential amino acid sequence |
MLMNYSDHKHYADCVITVQEHSIEMFINNLDRSTYTEILLLRTSSK*(+) MLMIRIIHQHQLIMFKRRIPCLDSYLDKVNLSLWPRFKMVFDLHLNSLRNANVKTLWEDDVHPH YVMRRYAEFTASLVHLNVEYGDGQLDLNLERLRMAVEELLVKLAKMFPKQKLQTVFLINNYDLT ISILKEAGTEGGKAQVHFEEVLKSNISVYVDLSKLLMNISMLCS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |