Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0719300_circ_g.4 |
| ID in PlantcircBase | osa_circ_021326 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 29139143-29139788 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0719300 |
| Parent gene annotation |
Similar to Dihydroxyacetone/glycerone kinase-like protein. (Os03 t0719300-01);Similar to Dihydroxyacetone kinase-like protein. (O s03t0719300-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0719300_circ_g.3 Os03g0719300_circ_g.5 Os03g0719300_circ_g.6 Os03g0719300_circ_g.7 Os03g0719300_circ_g.8 Os03g0719300_circ_g.9 Os03g0719300_circ_g.10 Os03g0719300_circ_g.11 Os03g0719300_circ_g.12 Os03g0719300_circ_g.13 Os03g0719300_circ_g.14 Os03g0719300_circ_g.15 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0719300-02:2 Os03t0719300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.169824278 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29139742-29139393(+) 29139188-29139730(-) |
| Potential amino acid sequence |
MVMVVLEQEFLLVDDFRFFRSSRIVVAPLYIVVPQSPSPTLLSHSFKLSLILIISLAPASIAAS RIHPCLLNS*(+) MYRGATTILEDLKKRKSSTSKNSCSSTTITIREG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |