Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G59780_circ_g.8 |
ID in PlantcircBase | ath_circ_028348 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 22089310-22089408 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G59780 |
Parent gene annotation |
Rhodanese/Cell cycle control phosphatase superfamily protein |
Parent gene strand | + |
Alternative splicing | AT3G59780_circ_g.1 AT3G59780_circ_g.2 AT3G59780_circ_g.3 AT3G59780_circ_g.4 AT3G59780_circ_g.5 AT3G59780_circ_g.6 AT3G59780_circ_g.7 AT3G59780_circ_g.9 AT3G59780_circ_g.10 |
Support reads | 5 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G59780.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.177610017 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22089322-22089405(+) 22089399-22089312(-) |
Potential amino acid sequence |
MQGGYRSWVQEGLRVKEPKPETTLTILNERPYLMQGGYRSWVQEGLRVKEPKPETTLTILNERP YLMQGGYRSWVQEGLRVKEPKPETTLTILNERPYLMQGGYRSWVQEGLRVKEPKPETTLTILNE (+) MVSVVSGFGSFTRRPSCTHDLYPPCIKYGLSLRMVSVVSGFGSFTRRPSCTHDLYPPCIKYGLS LRMVSVVSGFGSFTRRPSCTHDLYPPCIKYGLSLRMVSVVSGFGSFTRRPSCTHDLYPPCIKYG (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |