Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0545000_circ_g.18 |
| ID in PlantcircBase | osa_circ_028751 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 27047998-27048072 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0545000 |
| Parent gene annotation |
Similar to Phosphatidylinositol transfer-like protein IV. (Os05t 0545000-01);Similar to Phosphatidylinositol transfer-like protei n III. (Os05t0545000-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0545000_circ_g.11 Os05g0545000_circ_g.12 Os05g0545000_circ_g.13 Os05g0545000_circ_g.14 Os05g0545000_circ_g.15 Os05g0545000_circ_g.16 Os05g0545000_circ_g.17 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0545000-02:1 Os05t0545000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.128888889 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27048017-27048069(+) |
| Potential amino acid sequence |
MRQDELLAYIDKQDMIKFRALYEALMRQDELLAYIDKQDMIKFRALYEALMRQDELLAYIDKQD MIKFRALYEALMRQDELLAYIDKQDMIKFR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |