Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0545000_circ_g.18 |
ID in PlantcircBase | osa_circ_028751 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 27047998-27048072 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os05g0545000 |
Parent gene annotation |
Similar to Phosphatidylinositol transfer-like protein IV. (Os05t 0545000-01);Similar to Phosphatidylinositol transfer-like protei n III. (Os05t0545000-02) |
Parent gene strand | + |
Alternative splicing | Os05g0545000_circ_g.11 Os05g0545000_circ_g.12 Os05g0545000_circ_g.13 Os05g0545000_circ_g.14 Os05g0545000_circ_g.15 Os05g0545000_circ_g.16 Os05g0545000_circ_g.17 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0545000-02:1 Os05t0545000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.128888889 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27048017-27048069(+) |
Potential amino acid sequence |
MRQDELLAYIDKQDMIKFRALYEALMRQDELLAYIDKQDMIKFRALYEALMRQDELLAYIDKQD MIKFRALYEALMRQDELLAYIDKQDMIKFR(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |