Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc08g082730.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002731 |
| Alias | Slcirc127 |
| Organism | Solanum lycopersicum |
| Position | chr8: 65427832-65428283 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc08g082730.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 15 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc08g082730.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.359103287 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
65428247-65428011(+) 65427877-65427891(+) 65428009-65428265(-) |
| Potential amino acid sequence |
MSKLRSQTLLLMMELWFLHSSGCRSWGDGILLHEVEGLVIF*(+) MGYCYMKWKGWSFSDVMYVTKHNMANAVASVSKQLDNVSDALASTRRHLTKRLENLDWKLDEQI EISNLITNDGAMVLTFFRLPQLGRWDIVT*(+) MTNPSTSCNNIPSPQLRQPEECKNHSSIISNKV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2018b |