Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d051856_circ_g.3 |
| ID in PlantcircBase | zma_circ_008147 |
| Alias | zma_circ_0001588 |
| Organism | Zea mays |
| Position | chr4: 172482910-172484062 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d051856 |
| Parent gene annotation |
O-fucosyltransferase family protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d051856_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d051856_T011:2 Zm00001d051856_T014:2 Zm00001d051856_T013:2 Zm00001d051856_T012:2 Zm00001d051856_T009:2 Zm00001d051856_T015:2 Zm00001d051856_T016:2 Zm00001d051856_T003:2 Zm00001d051856_T017:2 Zm00001d051856_T004:2 Zm00001d051856_T008:2 Zm00001d051856_T002:2 Zm00001d051856_T010:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168678712 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
172484025-172484022(-) |
| Potential amino acid sequence |
MIKRGTVKEQLAVDSVSRKMAGLCPLMPEEVGLLLQAVGYPPTTIIFLAGSETFGGQRMLIPLR AMFANLVDRTSLCSQRELFDLVGPEDPRTPDLPQPPPPKSEKQLIEEWRRAGPRPRPLPPPPAR PFYAHEKEGWYGWIGENDTEPDASLIEFRRQAHQLLWDALDYFVSVEADAFFPGFHNDGSGWPD YSSLVMGHRLYQTPSGITYRPDRIFIQSLFSIEGIR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |