Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0176800_circ_g.1 |
| ID in PlantcircBase | osa_circ_036079 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 4498640-4500549 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0176800 |
| Parent gene annotation |
Similar to mRNA-associated protein mrnp 41 (Rae1 protein homolog ). (Os08t0176800-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0176800_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0176800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23663442 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4500466-4500501(-) |
| Potential amino acid sequence |
MIVGTADRNLVVFNLQNPQTEFKRIQSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHIDDSQQ SKNFTFKCHREGNDIFSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKVLGHKAIKSCPCS ATS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |