Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0383700_circ_g.4 |
| ID in PlantcircBase | osa_circ_001768 |
| Alias | Os01circ11829 |
| Organism | Oryza sativa |
| Position | chr1: 16048106-16048735 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os01g0383700 |
| Parent gene annotation |
Similar to LEC14B protein. (Os01t0383700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0383700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002057* |
| PMCS | 0.139355913 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16048414-16048617(+) 16048153-16048628(-) |
| Potential amino acid sequence |
MTWTVKPTYLNSPQMVPFSLGSHIRIYNAEKKWTIHKDITCKKLRWTVSDIALSPDQRYLYPNM GWKRKTHHGGSCHQQQSCPSHGNELSAIDEEVSHLTRLKSEPCERTRASLHAGKKRHISTFKLL SGRESNCLGIGRFSSADCSYALRKHLPVKGPWCVDDMDSEAYISQFSADGSLLIG*(+) MILHDVSSFSSPCLDIGIVDQVKEQYLKLSNVAFCRLCPYVSSTFSQHCRF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |