Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0383700_circ_g.4 |
ID in PlantcircBase | osa_circ_001768 |
Alias | Os01circ11829 |
Organism | Oryza sativa |
Position | chr1: 16048106-16048735 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os01g0383700 |
Parent gene annotation |
Similar to LEC14B protein. (Os01t0383700-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0383700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002057* |
PMCS | 0.139355913 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16048414-16048617(+) 16048153-16048628(-) |
Potential amino acid sequence |
MTWTVKPTYLNSPQMVPFSLGSHIRIYNAEKKWTIHKDITCKKLRWTVSDIALSPDQRYLYPNM GWKRKTHHGGSCHQQQSCPSHGNELSAIDEEVSHLTRLKSEPCERTRASLHAGKKRHISTFKLL SGRESNCLGIGRFSSADCSYALRKHLPVKGPWCVDDMDSEAYISQFSADGSLLIG*(+) MILHDVSSFSSPCLDIGIVDQVKEQYLKLSNVAFCRLCPYVSSTFSQHCRF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |