Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0573300_circ_g.5 |
| ID in PlantcircBase | osa_circ_029042 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 28553697-28553911 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0573300 |
| Parent gene annotation |
Similar to CTP synthase 1 (EC 6.3.4.2) (UTP--ammonia ligase 1) ( CTP synthetase 1). (Os05t0573300-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0573300_circ_g.1 Os05g0573300_circ_g.2 Os05g0573300_circ_g.3 Os05g0573300_circ_g.4 Os05g0573300_circ_g.6 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0573400-00:1 Os05t0573400-00:1 Os05t0573300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165891008 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28553898-28553875(+) |
| Potential amino acid sequence |
MSLLVRSFQFVEFAGSFSPFSQLRCSRHFSHTLKI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |