Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0816400_circ_g.1 |
ID in PlantcircBase | osa_circ_017151 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 34993069-34993404 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0816400 |
Parent gene annotation |
Protein of unknown function DUF3741 domain containing protein. ( Os02t0816400-01);Protein of unknown function DUF3741 domain cont aining protein. (Os02t0816400-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0816400-02:2 Os02t0816400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012471 |
PMCS | 0.194692386 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34993079-34993071(+) 34993226-34993386(-) |
Potential amino acid sequence |
MRGVQDRKQKKKQDLQVLGPFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRGNAFK MAIGPFSSQIEDKKC*(+) MRFLCEHLGRDHAIAEVKHVYHPTQASREGPENLQVLLLLLLPILNPSHLSTLFIFYL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |