Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G62780_circ_g.2 |
ID in PlantcircBase | ath_circ_008462 |
Alias | At_ciR5084 |
Organism | Arabidpsis thaliana |
Position | chr1: 23249655-23250076 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT1G62780 |
Parent gene annotation |
Dimethylallyl, adenosine tRNA methylthiotransferase |
Parent gene strand | - |
Alternative splicing | AT1G62780_circ_g.1 AT1G62780_circ_g.3 AT1G62780_circ_g.4 |
Support reads | 2/2 |
Tissues | leaf/leaf, inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G62780.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.193200631 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23249910-23249657(-) |
Potential amino acid sequence |
MQNELMTATNSLTKLLTSTDIKTTLLDMVEKNQINRSLLALLDENIANAYKGNQDIEDRLIELE TLQKALEEGIEAYDKMQNELMTATNSLTKLLTSTDIKTTLLDMVEKNQINRSLLALLDENIANA YKGNQDIEDRLIELETLQKALEEGIEAYDKMQNELMTATNSLTKLLTSTDIKTTLLDMVEKNQI NRSLLALLDENIANAYKGNQDIEDRLIELETLQKALEEGIEAYDKMQNELMTATNSLTKLLTST DIKTTLLDMVEKNQINRSLLALLDENIANAYKGNQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |