Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G62780_circ_g.2 |
| ID in PlantcircBase | ath_circ_008462 |
| Alias | At_ciR5084 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 23249655-23250076 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT1G62780 |
| Parent gene annotation |
Dimethylallyl, adenosine tRNA methylthiotransferase |
| Parent gene strand | - |
| Alternative splicing | AT1G62780_circ_g.1 AT1G62780_circ_g.3 AT1G62780_circ_g.4 |
| Support reads | 2/2 |
| Tissues | leaf/leaf, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G62780.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.193200631 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23249910-23249657(-) |
| Potential amino acid sequence |
MQNELMTATNSLTKLLTSTDIKTTLLDMVEKNQINRSLLALLDENIANAYKGNQDIEDRLIELE TLQKALEEGIEAYDKMQNELMTATNSLTKLLTSTDIKTTLLDMVEKNQINRSLLALLDENIANA YKGNQDIEDRLIELETLQKALEEGIEAYDKMQNELMTATNSLTKLLTSTDIKTTLLDMVEKNQI NRSLLALLDENIANAYKGNQDIEDRLIELETLQKALEEGIEAYDKMQNELMTATNSLTKLLTST DIKTTLLDMVEKNQINRSLLALLDENIANAYKGNQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |