Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g017890.2_circ_g.4 |
| ID in PlantcircBase | sly_circ_001723 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr5: 19101465-19105008 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc05g017890.2 |
| Parent gene annotation |
THO complex subunit 2 |
| Parent gene strand | - |
| Alternative splicing | Solyc05g017890.2_circ_g.3 |
| Support reads | NA |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc05g017890.2.1:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157444422 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19103178-19105007(-) 19103039-19104976(-) |
| Potential amino acid sequence |
MDEEKQGDVTVDLYAALDMETEAVAERSSELENSQPLGLLMGFLEVNDWYHAHVLFGRLSHLNP AEHVQICDGLFR*(-) MTGIMLMCCLAVSHISIQQNMYKYVMDYSGDSPLSNSRGF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tan et al., 2017 |