Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0183100_circ_g.2 |
ID in PlantcircBase | osa_circ_023046 |
Alias | Os_ciR5454 |
Organism | Oryza sativa |
Position | chr4: 5658450-5661933 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0183100 |
Parent gene annotation |
7TM GPCR, rhodopsin-like domain containing protein. (Os04t018310 0-01);Similar to OSIGBa0140C02.4 protein. (Os04t0183100-02) |
Parent gene strand | - |
Alternative splicing | Os04g0183100_circ_g.1 Os04g0183100_circ_g.3 |
Support reads | 3/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0183100-02:2 Os04t0183100-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015113 |
PMCS | 0.104552557 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5661929-5658521(+) 5661931-5660172(-) |
Potential amino acid sequence |
MILLFQKQLLQLLHVLQGPSYKVYQV*(+) MDLCNRAEKSKPLSPVYKVTKTVYASPSRVNFHLDRRKAVETVPAYPNICFSIDDFDDTFDAVQ VLSDPEHCYCVILNAHDGAAFPENTESKNPSSNVLSGVNTGSKQEKPPKRTLFSGYVSYQNVRE AYDAGRSKFESLFSLGHDRTKLDKLYMRGPEGRGEVEVAVSGIAVSWIFATVQRKANHYHQFIR SQKLCMHPRAA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |