Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0246400_circ_g.3 |
| ID in PlantcircBase | osa_circ_036505 |
| Alias | Os_ciR1701 |
| Organism | Oryza sativa |
| Position | chr8: 8958159-8958284 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0246400 |
| Parent gene annotation |
Similar to Ubiquinol-cytochrome c reductase complex 14 kDa prote in (EC 1.10.2.2) (CR14). (Os08t0246400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0246400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.720238624 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8958160-8958281(+) |
| Potential amino acid sequence |
MPTYPATVFGENDGDGISLLLYFKLSGSFDKEISPQLKQSIKMPTYPATVFGENDGDGISLLLY FKLSGSFDKEISPQLKQSIKMPTYPATVFGENDGDGISLLLYFKLSGSFDKEISPQLKQSIKMP TYPATVFGENDGDGISLLLYFKLSGSFDKEISPQLKQSIK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |