Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G44910_circ_g.10 |
ID in PlantcircBase | ath_circ_006052 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 16980552-16980932 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G44910 |
Parent gene annotation |
Pre-mRNA-processing protein 40A |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G44910.2:3 AT1G44910.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.183591295 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16980588-16980929(+) |
Potential amino acid sequence |
MADYRKFLETCDYIKAGTQWRKIQDRLEDDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEK EREKAAEEHRQYMADYRKFLETCDYIKAGTQWRKIQDRLEDDDRCSCLEKIDRLIGFEEYILDL EKEEEELKRVEKEREKAAEEHRQYMADYRKFLETCDYIKAGTQWRKIQDRLEDDDRCSCLEKID RLIGFEEYILDLEKEEEELKRVEKEREKAAEEHRQYMADYRKFLETCDYIKAGTQWRKIQDRLE DDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |