Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0568600_circ_g.2 |
ID in PlantcircBase | osa_circ_034362 |
Alias | Os_ciR11023 |
Organism | Oryza sativa |
Position | chr7: 22859315-22860119 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0568600 |
Parent gene annotation |
Similar to Calcium-dependent protein kinase. (Os07t0568600-01);S imilar to calcium-dependent protein kinase, isoform AK1. (Os07t0 568600-02) |
Parent gene strand | - |
Alternative splicing | Os07g0568600_circ_g.3 Os07g0568650_circ_g.1 Os07g0568650_circ_g.2 Os07g0568650_circ_g.3 Os07g0568650_circ_g.4 Os07g0568650_circ_g.5 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0568600-01:3 Os07t0568600-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.316018903 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22860035-22860080(-) |
Potential amino acid sequence |
MNKFKKHALRVIAEHLSVEEVAGIKDMFEKMDLNKDNMINFDELKLGLHKLGHQMADADVQILM DAADVDGNGSLDYGEFVALSVHLRKIGNDEHLHKAFAYFDRNQSGYIEIDELRESLADDLGANH EEVINAIIRDVDTDKIILGYRTLRRLQM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |