Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0866300_circ_g.1 |
ID in PlantcircBase | osa_circ_004966 |
Alias | Os_ciR4520 |
Organism | Oryza sativa |
Position | chr1: 37515753-37517486 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0866300 |
Parent gene annotation |
VAMP-like protein YKT61 (AtYKT61) (Geranylgeranylated protein 1) (AtGP1). (Os01t0866300-01);VAMP-like protein YKT61 (AtYKT61) (G eranylgeranylated protein 1) (AtGP1). (Os01t0866300-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0866300-02:4 Os01t0866300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.116100644 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37515804-37515842(+) |
Potential amino acid sequence |
MDDHYPVRSAFSLLNKVLDEYQKAFGDSWKAATKDATDAAQQWPFLTDALTKFQDPAEADKLMK IQRDLDETKIILHKTIESVLQRGERLDSLVEKSSDLSAASQNTRSTHTTGMVFAQLHLWMITIL YEVHFLF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |