Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0866300_circ_g.1 |
| ID in PlantcircBase | osa_circ_004966 |
| Alias | Os_ciR4520 |
| Organism | Oryza sativa |
| Position | chr1: 37515753-37517486 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0866300 |
| Parent gene annotation |
VAMP-like protein YKT61 (AtYKT61) (Geranylgeranylated protein 1) (AtGP1). (Os01t0866300-01);VAMP-like protein YKT61 (AtYKT61) (G eranylgeranylated protein 1) (AtGP1). (Os01t0866300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0866300-02:4 Os01t0866300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116100644 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37515804-37515842(+) |
| Potential amino acid sequence |
MDDHYPVRSAFSLLNKVLDEYQKAFGDSWKAATKDATDAAQQWPFLTDALTKFQDPAEADKLMK IQRDLDETKIILHKTIESVLQRGERLDSLVEKSSDLSAASQNTRSTHTTGMVFAQLHLWMITIL YEVHFLF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |