Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0164700_circ_g.3 |
| ID in PlantcircBase | osa_circ_000414 |
| Alias | Os_ciR6177 |
| Organism | Oryza sativa |
| Position | chr1: 3339510-3340257 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0164700 |
| Parent gene annotation |
Uncharacterised protein family UPF0363 domain containing protein . (Os01t0164700-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0164700_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0164700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010849 |
| PMCS | 0.236715842 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3340158-3339846(+) 3339751-3340215(-) 3339534-3340202(-) |
| Potential amino acid sequence |
MFFLNQKNIFINIFLTAQCYPGEDDTAIARGVLMWSAEVGASRSGSPELHVMLAEYIYSESPET DMTKVSSHFVRGNDPKKFASMLANFMGKVMVFRK*(+) MSVSGDSEYMYSANITCSSGDPLLDAPTSADHIRTPRAIAVSSSPG*(-) MPQPQQTTLGHHVLLQYHLHQGSTVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |