Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0164700_circ_g.3 |
ID in PlantcircBase | osa_circ_000414 |
Alias | Os_ciR6177 |
Organism | Oryza sativa |
Position | chr1: 3339510-3340257 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os01g0164700 |
Parent gene annotation |
Uncharacterised protein family UPF0363 domain containing protein . (Os01t0164700-01) |
Parent gene strand | + |
Alternative splicing | Os01g0164700_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0164700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010849 |
PMCS | 0.236715842 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3340158-3339846(+) 3339751-3340215(-) 3339534-3340202(-) |
Potential amino acid sequence |
MFFLNQKNIFINIFLTAQCYPGEDDTAIARGVLMWSAEVGASRSGSPELHVMLAEYIYSESPET DMTKVSSHFVRGNDPKKFASMLANFMGKVMVFRK*(+) MSVSGDSEYMYSANITCSSGDPLLDAPTSADHIRTPRAIAVSSSPG*(-) MPQPQQTTLGHHVLLQYHLHQGSTVQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |