Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0232800_circ_g.1 |
ID in PlantcircBase | osa_circ_000966 |
Alias | Os_ciR6589 |
Organism | Oryza sativa |
Position | chr1: 7353604-7354585 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0232800 |
Parent gene annotation |
Similar to KOB1. (Os01t0232800-01) |
Parent gene strand | - |
Alternative splicing | Os01g0232800_circ_g.2 Os01g0232800_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0232800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.338140334 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7353785-7353694(+) 7353763-7353618(+) 7353787-7353616(-) |
Potential amino acid sequence |
METSVKGSLMSSRSMLLSLGFSCNYAIYEHHLDADAPEPLLLISHYRK*(+) MIIIFLKHGNLCERIFDVISLNAALFGVFM*(+) MFKKNYDHLPKDTYFGLYKEATRGNPNYFLTYGNGKSAARVQEHLRPNGAHRWHNYMKTPKRAA LSEMTSKILSQRFPCLRKIMIIFQRIHILAYTKKQRVVIQTIFSLTVMGNQQQGFRSICVQMVL IDGIIT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |