Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA036341_circ_g.4 |
ID in PlantcircBase | osi_circ_003398 |
Alias | 12:9052222|9059495 |
Organism | Oryza sativa ssp. indica |
Position | chr12: 9052222-9059495 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA036341 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA036341_circ_g.1 BGIOSGA036341_circ_g.2 BGIOSGA036341_circ_g.3 BGIOSGA036341_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA036341-TA:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9059489-9059459(-) |
Potential amino acid sequence |
MVDKQVDATLIRLRALYTRAKELCESEVSASSALVGLLDGLLQSGTSAAQRKKIEVGEQKKKRM KSDTDTTRFSSASMRSQLDQATNLKGEQVAAKVKSDEEKDEWFVVKVIHFDKETKEYEVLDEEP GDDEESAQKKYKLPMSDIIPFPKRGDPSSAPDFGQGRQVLAVYPSTTALYRATVASNRKLQRWL INRLMLR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |