Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0181000_circ_g.1 |
| ID in PlantcircBase | osa_circ_032998 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 4269349-4269470 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0181000 |
| Parent gene annotation |
Similar to Pyruvate kinase isozyme A, chloroplast precursor (EC 2.7.1.40). (Os07t0181000-01);Similar to Pyruvate kinase. (Os07t0 181000-02);Similar to Pyruvate kinase. (Os07t0181000-03);Similar to Pyruvate kinase. (Os07t0181000-04) |
| Parent gene strand | + |
| Alternative splicing | Os07g0181000_circ_g.2 Os07g0181000_circ_g.3 Os07g0181000_circ_g.4 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0181000-03:1 Os07t0181000-04:1 Os07t0181000-02:1 Os07t0181000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.302591803 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4269437-4269446(-) |
| Potential amino acid sequence |
MVNYFCRFDKRNCNKIYAFRNSKVYVKPILPRLLAAI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |