Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G177000_circ_g.2 |
| ID in PlantcircBase | gma_circ_007790 |
| Alias | gma-circRNA2783 |
| Organism | Glycine max |
| Position | chr20: 41416178-41417890 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_20G177000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_20G177000_circ_g.1 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG91832:3 KRG91834:3 KRG91831:3 KRG91827:3 KRG91828:3 KRG91830:3 KRG91833:3 KRG91829:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.219973127 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41416905-41416244(+) 41416286-41417883(-) 41416227-41417845(-) |
| Potential amino acid sequence |
MFDILRRRVTCEARNNYNNGNRFIFRSNITRNRILAPILVPTTNRGAMDFSLWR*(+) MLDGLRISAQWLIISIKRNPWHLCLLLELVLELIFCFW*(-) MAPLFVVGTSIGANILFLVMLLLKMNLFPLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |