Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0236900_circ_g.2 |
| ID in PlantcircBase | osa_circ_010932 |
| Alias | Os_ciR7582 |
| Organism | Oryza sativa |
| Position | chr12: 7549612-7551263 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0236900 |
| Parent gene annotation |
SET domain containing protein. (Os12t0236900-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0236900_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0237000-00:4 Os12t0237000-00:4 Os12t0236900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010304 |
| PMCS | 0.130920379 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7551203-7549618(+) 7549617-7550757(-) |
| Potential amino acid sequence |
MGVTSNGVLINDHIQLKCIRRHP*(+) MPSNALQLDVIINENTIRSDTHVARINARCMLYFSYFNSGANGAGQGDTVWSGKSFMNSLAAWR QPCNNFFSNLTSLVATSFFGSKLPSANIASSSSKVVG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |