Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0236900_circ_g.2 |
ID in PlantcircBase | osa_circ_010932 |
Alias | Os_ciR7582 |
Organism | Oryza sativa |
Position | chr12: 7549612-7551263 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os12g0236900 |
Parent gene annotation |
SET domain containing protein. (Os12t0236900-01) |
Parent gene strand | + |
Alternative splicing | Os12g0236900_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0237000-00:4 Os12t0237000-00:4 Os12t0236900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010304 |
PMCS | 0.130920379 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7551203-7549618(+) 7549617-7550757(-) |
Potential amino acid sequence |
MGVTSNGVLINDHIQLKCIRRHP*(+) MPSNALQLDVIINENTIRSDTHVARINARCMLYFSYFNSGANGAGQGDTVWSGKSFMNSLAAWR QPCNNFFSNLTSLVATSFFGSKLPSANIASSSSKVVG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |