Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0195000_circ_g.1 |
ID in PlantcircBase | osa_circ_013627 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 5325330-5326432 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0195000 |
Parent gene annotation |
Protein of unknown function DUF2048 domain containing protein. ( Os02t0195000-01);Protein of unknown function DUF2048 domain cont aining protein. (Os02t0195000-02) |
Parent gene strand | - |
Alternative splicing | Os02g0195000_circ_g.2 Os02g0195000_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0195000-01:3 Os02t0195000-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.296716859 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5326211-5325537(+) 5326363-5326381(-) |
Potential amino acid sequence |
MLHAWSPLSIIRALKNHSCNVVLQKRSTKSKSSLKRVITSAVAPTKMTACGFFGTGNRVTSVKD STDRNLSLTCSIVIPDFWAMSSVKEVTSWANVAASFLNASQAVACL*(+) MVLESPYYGQRRPSMQHGSKLQCVSDLLLLGKATIDEARSLLYWLQNEAGYGKMGICGLSMGGV HAAMVGSLHPTPIATLPFLAPHSAVVPFCDGLYRHATAWDALRKDAATLAQDVTSLTEDMAQKS GITIEQVRERLRSVLSLTDVTRFPVPKNPQAVIFVGATALVITRLREDFDLVDLF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |