Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0562200_circ_g.1 |
| ID in PlantcircBase | osa_circ_038107 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 28147956-28148171 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0562200 |
| Parent gene annotation |
Similar to CUC2. (Os08t0562200-02);Hypothetical conserved gene. (Os08t0562200-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0562200-03:1 Os08t0562200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.175644869 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28147996-28147958(-) |
| Potential amino acid sequence |
MEKGYLQMSDLVQDSFVVCRIFQKAGPGPQNGAQYGAPFVEEEWEEDDEDVGLLPVEEKDNSDD QEKEISGAMEKGYLQMSDLVQDSFVVCRIFQKAGPGPQNGAQYGAPFVEEEWEEDDEDVGLLPV EEKDNSDDQEKEISGAMEKGYLQMSDLVQDSFVVCRIFQKAGPGPQNGAQYGAPFVEEEWEEDD EDVGLLPVEEKDNSDDQEKEISGAMEKGYLQMSDLVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |